PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 654aa    MW: 71419.9 Da    PI: 6.3456
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32656genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.11.9e-28213266155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  EMT32656 213 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 266
               79*******************.********************************8 PP

2Response_reg78.42.6e-26251331109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l++ +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge + +l+ +  Ga 
      EMT32656  25 VLAVDDDPVCLKVLEVLLRRCQY-HVTTTNQAATALRLLRENKdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKSVLKGITHGAC 119
                   799********************.***************99999********************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel++
      EMT32656 120 DYLLKPVRIEELRN 133
                   ************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363929.8E-1781654IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.4E-4122161No hitNo description
SuperFamilySSF521726.26E-3522149IPR011006CheY-like superfamily
SMARTSM004485.6E-3123135IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.85824139IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.8E-2325133IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.34E-2626138No hitNo description
PROSITE profilePS5129411.131210269IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-30211271IPR009057Homeodomain-like
SuperFamilySSF466891.79E-19211270IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-25213266IPR006447Myb domain, plants
PfamPF002491.2E-6215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MMMEARKGLM ERERERDQFP VGMRVLAVDD DPVCLKVLEV LLRRCQYHVT TTNQAATALR  60
LLRENKDMFD LVISDVHMPD MDGFKLLELV GLEMDLPVIM LSVNGETKSV LKGITHGACD  120
YLLKPVRIEE LRNVWQHVVR RKFSNREPNN NLDLCKEISK PPSADSYPRL GQATCDSHRS  180
CDQSNRAGKK RKEPHSEEED DGEDNDDAAG SKKPRVVWSV ELHRKFVAAV NQLGIDKAVP  240
KRILELMNVE KLTRENVASH LQKYRLYLRR LSAVASQQAS IAAAFGGRDP FLHMGAFEGL  300
HSYHQPFAPS AALPSFNPHG LLSSAGAAAF GLQDLASPKA NQCSSSNGIA SHCAGDTEKF  360
HIVSLQDNQQ ADLSQGLTAS SLGQPQLQQK WIHQETNDLC SVISGGALAN TMSGTLQRVT  420
SSSLPPEDLL ECTPHIKVGA HPSIGIPTGS SGLLERSVGV SANLRDSCIS QQCALPISEG  480
FSVNKLPLHI PFDGTGVTKL DASFVAGEQE MDQKGIFLER MSVSVCPSES LIVASNAKCR  540
ASSSGSIILP LPRDTERHSK YLQFGAASNS RHRMDGMRQD QRLNSGGFSY DGGAIVPEQT  600
DMYDLGVPKL QGGFNSSSCN FDGLLNSIIK VESDEVPFTE NDLGCELFPL GACI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-24210272264ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3699660.0AK369966.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2102E11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564200.10.0PREDICTED: two-component response regulator ORR22
SwissprotB8B3I40.0ORR22_ORYSI; Two-component response regulator ORR22
TrEMBLM8D8380.0M8D838_AEGTA; Two-component response regulator ARR12
STRINGMLOC_61880.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-106response regulator 12